0
Skip to Content
Neylon's Pharmacy  Barna
Home
About
Order Prescription
Transfer Prescription
Book Service
Store
Neylon's Pharmacy  Barna
Home
About
Order Prescription
Transfer Prescription
Book Service
Store
Home
About
Order Prescription
Transfer Prescription
Book Service
Store
Store Paralief 500mg effervescent tablets 24s
neylonspharmacyparaliefeffervescent.jpg Image 1 of
neylonspharmacyparaliefeffervescent.jpg
neylonspharmacyparaliefeffervescent.jpg

Paralief 500mg effervescent tablets 24s

€4.60

Paralief Effervescent Tablets contains paracetamol, which belongs to a group of medicines called analgesics and antipyretics that relieve mild to moderate pain and/or fever. The tablets dissolve in water prior to taking.

Paracetamol can be used to relieve headache, migraine, neuralgia, toothache, period pain, rheumatic aches and pains, sore throat and the symptoms of colds and flu.

  • Fast acting pain relief

  • Gentle on the stomach

CONTAINS PARACETAMOL. Do not take any other paracetamol-containing products. Do not exceed the stated dose.

Quantity:
Add To Cart

Paralief Effervescent Tablets contains paracetamol, which belongs to a group of medicines called analgesics and antipyretics that relieve mild to moderate pain and/or fever. The tablets dissolve in water prior to taking.

Paracetamol can be used to relieve headache, migraine, neuralgia, toothache, period pain, rheumatic aches and pains, sore throat and the symptoms of colds and flu.

  • Fast acting pain relief

  • Gentle on the stomach

CONTAINS PARACETAMOL. Do not take any other paracetamol-containing products. Do not exceed the stated dose.

Difflam Spray 30 ml
Difflam Spray 30 ml
€12.00

Paralief Effervescent Tablets contains paracetamol, which belongs to a group of medicines called analgesics and antipyretics that relieve mild to moderate pain and/or fever. The tablets dissolve in water prior to taking.

Paracetamol can be used to relieve headache, migraine, neuralgia, toothache, period pain, rheumatic aches and pains, sore throat and the symptoms of colds and flu.

  • Fast acting pain relief

  • Gentle on the stomach

CONTAINS PARACETAMOL. Do not take any other paracetamol-containing products. Do not exceed the stated dose.

Adults and >16 years old: Take 1-2 tablets, dissolved in water every 4-6 hours if needed for pain relief

  • Do not exceed 8 tablets in 24 hours

  • Adolescents (12-15 years weighing 41-50kg) Take 1 tablet every 4-6 hours. Max of 4 tablets in 24 hours.

  • Do not take Paralief effervescent tablets for more than 10 days without consulting the doctor.

Do not drink alcohol (e.g. wine, beer, spirits) whilst taking this medicine. Do not use paracetamol unless prescribed by your doctor if you have an addiction to alcohol or liver Page 1 of 5 damage

Warnings and precautions - Talk to your doctor, pharmacist or nurse before taking Paralief effervescent tablets:

  • If you are suffering from kidney problems.

  • If you are suffering from liver problems including liver problems due to excessive alcohol consumption.

  • If you have Gilbert’s syndrome (mild jaundice).

  • If you have haemolytic anaemia (abnormal breakdown of red blood cells).

  • If you are an asthmatic and sensitive to aspirin (acetylsalicylic acid).

  • If you are suffering from dehydration or chronic malnutrition.

  • If you are on paracetamol containing medicines.

  • If you have fever after paracetamol therapy.

  • If you suffer from glucose-6-phosphate dehydrogenase deficiency(enzyme deficiency).

Paralief Paracetamol Tablets in Pregnancy

  • Paralief effervescent tablets can be used during pregnancy.

  • You should use the lowest possible dose that reduces your pain and/or your fever and use it for the shortest time possible.

  • Contact your doctor or pharmacist if the pain and/or fever are not reduced or if you need to take the medicine more often.

Neylon’s Pharmacy

Unit 2, An Creagan,

Barna, Galway H91 RR44

neylonsbarna@gmail.com
(091) 867070

 

Opening Hours:

Mon to Fri: 9.30am - 6.30pm

Sat: 9.30 - 6.00pm

Sun: Closed

Bank Holidays: 11.00am - 3.00pm


Subscribe

Sign up with your email address to receive news and updates.

We respect your privacy.

Thank you!